Archangium gephyra: AA314_08797 Help Entry AA314_08797       CDS       T03948                                  Name (GenBank) Putative MbtH-like protein   KO K05375   MbtH protein Organism age  Archangium gephyra Pathway age00261   Monobactam biosynthesis age01100   Metabolic pathways age01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:age00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AA314_08797  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:age01008]     AA314_08797 Polyketide biosynthesis proteins [BR:age01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AA314_08797 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AKJ07171 UniProt:  A0AAC8TJW2 LinkDB All DBs Position complement(10956714..10956929) Genome browser AA seq 71 aa AA seqDB search MSDTEDTQQYKVVVNHEEQYSIWPADRENAPGWKDAGKSGTKAECLEHIKQVWTDMRPLS LRKKMDAQKGS NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcgacaccgaggacacgcagcagtacaaggtcgtggtcaaccacgaggagcagtac tccatctggcccgccgaccgggagaacgcccccggctggaaggacgccggcaagtccggc accaaggccgagtgcctcgagcacatcaagcaggtgtggacggacatgcgtccgctcagc ctgcgcaagaagatggacgcgcagaagggctcgtga

DBGET integrated database retrieval system