Actinacidiphila glaucinigra: OIE69_04020 Help Entry OIE69_04020       CDS       T09685                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism agla  Actinacidiphila glaucinigra Pathway agla00261   Monobactam biosynthesis agla01100   Metabolic pathways agla01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:agla00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     OIE69_04020  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:agla01008]     OIE69_04020 Polyketide biosynthesis proteins [BR:agla01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     OIE69_04020 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WSD58119 LinkDB All DBs Position complement(917345..917551) Genome browser AA seq 68 aa AA seqDB search MSSNPFENPDGVYSVLVNAEGQHSLWPDFVTVPAGWTVAHGPAGRQECLEYVETHWTDLR PKSLVEGR NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgagcagcaaccccttcgagaaccccgacggcgtctactccgtcctggtcaacgccgag ggccagcacagcctgtggccggacttcgtcaccgtcccggccggctggacggtcgcccac ggtccggcgggccgccaggagtgcctggagtacgtggagacccactggacggacctgcgc cccaagagcctcgtcgagggccggtaa

DBGET integrated database retrieval system