Actinomadura graeca: AGRA3207_007774 Help Entry AGRA3207_007774   CDS       T07938                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism agra  Actinomadura graeca Pathway agra00261   Monobactam biosynthesis agra01100   Metabolic pathways agra01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:agra00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AGRA3207_007774  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:agra01008]     AGRA3207_007774 Polyketide biosynthesis proteins [BR:agra01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AGRA3207_007774 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXJ26159 LinkDB All DBs Position 8858000..8858209 Genome browser AA seq 69 aa AA seqDB search MMTNPFDDPDGTFLVLVNDEGQHSLWPSFADVPSGWATAFGPGPRAGCLDYVTANWTDIR PRSLADRPN NT seq 210 nt NT seq  +upstreamnt  +downstreamnt gtgatgaccaacccgttcgacgaccccgacggcaccttcctcgtcctcgtcaacgacgaa ggccagcattccctgtggccctcgttcgcggacgtcccgtccggctgggcgacggcgttc ggccccggcccccgcgccggctgcctcgactacgtcacggcgaactggaccgacatccgc ccccgcagcctggcggaccgcccgaactga

DBGET integrated database retrieval system