Aquisphaera giovannonii: OJF2_32750 Help Entry OJF2_32750        CDS       T06184                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism agv  Aquisphaera giovannonii Pathway agv00261   Monobactam biosynthesis agv01100   Metabolic pathways agv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:agv00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     OJF2_32750  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:agv01008]     OJF2_32750 Polyketide biosynthesis proteins [BR:agv01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     OJF2_32750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEH34733 UniProt:  A0A5B9W2C8 LinkDB All DBs Position 4404361..4404573 Genome browser AA seq 70 aa AA seqDB search MPSEEKPETIYRVVRNHEEQYSIWFTDRELPPGWDEAGRSGTKDECLAYIEEVWTDMRPL SLRKRMDEAS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgccgtccgaggagaagccggagacgatctaccgggtggtgaggaaccacgaggagcag tattcgatctggttcaccgaccgcgagctgcccccgggatgggacgaggccggcaggtcg gggacgaaggacgaatgccttgcgtatatcgaggaggtctggaccgacatgcggcctctg agcctccgcaagcggatggacgaggcgagctga

DBGET integrated database retrieval system