Arachis hypogaea (peanut): 112740996 Help Entry 112740996         CDS       T07294                                  Name (RefSeq) dihydroneopterin aldolase 1-like   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ahf  Arachis hypogaea (peanut) Pathway ahf00790   Folate biosynthesis ahf01100   Metabolic pathways ahf01240   Biosynthesis of cofactors Module ahf_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ahf00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     112740996 Enzymes [BR:ahf01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      112740996  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      112740996  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      112740996 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-GeneID:  112740996 NCBI-ProteinID:  XP_025645542 LinkDB All DBs Position Arahy.14:3640148..3641431 Genome browser AA seq 104 aa AA seqDB search METESLMRGDKLILRGLMFHGFHGVNPEERTLGQKFLVDIDAWIDLRAAGKSDNLSDSVS YTDIYRIVKEVIEGPPHNLLESVAQKIASTTLTNHHQISSYRSS NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggaaactgaatcacttatgaggggtgacaaactcattctgaggggattaatgttccat ggttttcatggtgtgaatccagaagaaagaacacttggtcagaaattcttggtagatata gatgcttggattgatcttagagctgctggtaaatctgataacttgtcagattcagttagc tacacagatatataccgaatagtaaaggaagttattgaagggccacctcacaaccttctg gaatcagtggctcaaaagattgcaagcacaactctaaccaatcaccatcagatatctagt tataggtccagttga

DBGET integrated database retrieval system