Aeromonas hydrophila AL06-06: RY45_19925 Help Entry RY45_19925        CDS       T03748                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ahh  Aeromonas hydrophila AL06-06 Pathway ahh00790   Folate biosynthesis ahh01100   Metabolic pathways ahh01240   Biosynthesis of cofactors Module ahh_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ahh00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     RY45_19925 Enzymes [BR:ahh01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      RY45_19925  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      RY45_19925  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      RY45_19925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AJQ56217 LinkDB All DBs Position 4381393..4381764 Genome browser AA seq 123 aa AA seqDB search MDKVFIRGLEVLTTIGVYEWEKGIRQKLCFDLEMGFDNRPAAATDDIKLALDYATLSRKI CDHASSKVVELVETMAEQVAMLVLADERVQWVKVTLTKPGAVPNAAGVGVEILRHRTPAA SAN NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggacaaggtgtttattcgcggactcgaggttttgaccactatcggtgtatacgagtgg gagaaaggcattcgccagaagctctgtttcgacctcgagatggggttcgacaaccgcccc gccgccgcaaccgacgatatcaagctggcactggattacgccaccctctctcgcaagatc tgtgatcacgcctccagcaaggtggtggagctggtcgaaaccatggccgaacaggtcgcc atgctggtgctggccgacgaacgggtacagtgggtcaaggtcaccctgaccaaaccgggc gccgtccccaatgccgccggcgtcggtgtcgagatcctgcgtcaccgcaccccggccgcg agcgccaactga

DBGET integrated database retrieval system