Actinoalloteichus hymeniacidonis: TL08_16370 Help Entry TL08_16370        CDS       T04472                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism ahm  Actinoalloteichus hymeniacidonis Pathway ahm00261   Monobactam biosynthesis ahm01100   Metabolic pathways ahm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ahm00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     TL08_16370  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ahm01008]     TL08_16370 Polyketide biosynthesis proteins [BR:ahm01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     TL08_16370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 DR2241 Motif Other DBs NCBI-ProteinID:  AOS64074 UniProt:  A0AAC9HRM2 LinkDB All DBs Position complement(3871016..3871231) Genome browser AA seq 71 aa AA seqDB search MSTNPFDDPDGRYLVLVNEEGQHSLWPSFAEVPAGWTAALEETDRQSALDYVNENWTDMR PKSLIRAMDGS NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaacccattcgacgaccccgacggccggtacctggtcttggtcaacgaggag ggccagcactccctctggccgtcgttcgccgaggtacccgcaggctggaccgcggcgttg gaggagaccgaccggcagagcgctctggactacgtcaatgagaactggaccgacatgcgg cccaagagcctgatccgggcgatggacggtagctga

DBGET integrated database retrieval system