Actinoplanes ianthinogenes: Aiant_51500 Help Entry Aiant_51500       CDS       T07429                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism aih  Actinoplanes ianthinogenes Pathway aih00261   Monobactam biosynthesis aih01100   Metabolic pathways aih01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aih00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Aiant_51500  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:aih01008]     Aiant_51500 Polyketide biosynthesis proteins [BR:aih01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Aiant_51500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCJ44493 LinkDB All DBs Position 5628042..5628269 Genome browser AA seq 75 aa AA seqDB search MTDTDEMYVIVRNHEEQYSIWRSGRPVPAGWEPVGEPASRDDCLARIGELWTDMRPASLR AAMSASAEEQGTHSG NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgaccgacaccgacgagatgtacgtgattgtccgcaaccacgaggagcagtactcgatc tggcggtcgggtcggccggtaccggccgggtgggagccggtcggcgagccggcgtcccgg gacgactgtctcgcgcgcatcggcgagttgtggacggacatgcgcccggccagcctgcgg gccgccatgagcgcctccgctgaggagcaagggacgcacagtggctga

DBGET integrated database retrieval system