Actinoplanes ianthinogenes: Aiant_51780 Help Entry Aiant_51780       CDS       T07429                                  Symbol mbtH Name (GenBank) protein MbtH   KO K05375   MbtH protein Organism aih  Actinoplanes ianthinogenes Pathway aih00261   Monobactam biosynthesis aih01100   Metabolic pathways aih01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aih00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Aiant_51780 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:aih01008]     Aiant_51780 (mbtH) Polyketide biosynthesis proteins [BR:aih01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Aiant_51780 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCJ44521 LinkDB All DBs Position complement(5664715..5664906) Genome browser AA seq 63 aa AA seqDB search MNPFDDPEGRFLVLVNDEEQHSLWPSRRAVPAGWRIVYGEDSRQACLDYVEQHWTDLRPL SVR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgaacccgttcgacgacccggagggccgattcctggtgctcgtcaacgacgaggagcag cactcgctgtggccgagccgccgggcggtacccgccggctggcgcatcgtgtacggcgag gacagccggcaggcgtgtctggactacgtcgagcagcactggaccgacctgcgtccgctg agcgtgcgctga

DBGET integrated database retrieval system