Acidaminococcus intestini: Acin_0620 Help Entry Acin_0620         CDS       T01639                                  Name (GenBank) conserved hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ain  Acidaminococcus intestini Pathway ain00020   Citrate cycle (TCA cycle) ain00720   Other carbon fixation pathways ain01100   Metabolic pathways ain01110   Biosynthesis of secondary metabolites ain01120   Microbial metabolism in diverse environments ain01200   Carbon metabolism ain01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ain00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Acin_0620   09102 Energy metabolism    00720 Other carbon fixation pathways     Acin_0620 Enzymes [BR:ain01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Acin_0620 SSDB OrthologParalogGFIT Motif Pfam:  Fer4_10 Fer4 Fer4_7 Fer4_2 Fer4_6 Fer4_21 Fer4_15 Fer4_9 LdpA_Fe-S-bd Fer4_3 Fer4_16 Fer4_4 Fer4_13 Fer4_8 Fer4_17 Fer4_22 Motif Other DBs NCBI-ProteinID:  AEQ21859 UniProt:  G4Q465 LinkDB All DBs Position 628167..628385 Genome browser AA seq 72 aa AA seqDB search MKEGKRMSKISVDYTRCKGCFLCVSVCPKQALTPSTELGEKGYEIVHLDEEKCIGCGSCY RMCPDYCIEITN NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgaaagaagggaaaagaatgagcaaaataagtgtggattatacgcgctgcaaaggctgt ttcctgtgtgtcagcgtctgtccgaagcaagcgctcacaccatccacggaactgggtgag aaaggctatgaaattgttcatttagacgaagaaaaatgtattggctgcggttcctgttat aggatgtgccccgattattgcatcgaaatcacgaattaa

DBGET integrated database retrieval system