Acidaminococcus intestini: Acin_0620 Help Entry Acin_0620         CDS       T01639                                  Name (GenBank) conserved hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ain  Acidaminococcus intestini Pathway ain00020   Citrate cycle (TCA cycle) ain01100   Metabolic pathways ain01110   Biosynthesis of secondary metabolites ain01120   Microbial metabolism in diverse environments ain01200   Carbon metabolism ain01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ain00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Acin_0620 Enzymes [BR:ain01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Acin_0620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_7 Fer4_2 Fer4_6 Fer4_21 Fer4_9 Fer4_15 Fer4_3 Fer4_16 Fer4_13 Fer4_4 Fer4_8 Fer4_17 Fer4_22 Motif Other DBs NCBI-ProteinID:  AEQ21859 UniProt:  G4Q465 LinkDB All DBs Position 628167..628385 Genome browser AA seq 72 aa AA seqDB search MKEGKRMSKISVDYTRCKGCFLCVSVCPKQALTPSTELGEKGYEIVHLDEEKCIGCGSCY RMCPDYCIEITN NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgaaagaagggaaaagaatgagcaaaataagtgtggattatacgcgctgcaaaggctgt ttcctgtgtgtcagcgtctgtccgaagcaagcgctcacaccatccacggaactgggtgag aaaggctatgaaattgttcatttagacgaagaaaaatgtattggctgcggttcctgttat aggatgtgccccgattattgcatcgaaatcacgaattaa

DBGET integrated database retrieval system