Alistipes indistinctus: AI2BBH_23700 Help Entry AI2BBH_23700      CDS       T06978                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ait  Alistipes indistinctus Pathway ait00020   Citrate cycle (TCA cycle) ait01100   Metabolic pathways ait01110   Biosynthesis of secondary metabolites ait01120   Microbial metabolism in diverse environments ait01200   Carbon metabolism ait01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ait00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     AI2BBH_23700 Enzymes [BR:ait01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      AI2BBH_23700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_21 Fer4 Fer4_10 Fer4_6 Fer4_7 Fer4_2 Fer4_9 Fer4_4 Fer4_16 Fer4_15 Fer4_17 Fer4_22 Fer4_13 Fer4_3 Fer4_8 Fer4_18 Motif Other DBs NCBI-ProteinID:  BCG55324 UniProt:  A0A5B5UDJ0 LinkDB All DBs Position complement(2976807..2977037) Genome browser AA seq 76 aa AA seqDB search MAKIKGTVVIDKERCKGCNLCVVACPVQVLALAGEVNGKGYNYSQMVRPDDCIGCASCAI VCPDSCIAVYRQKFEE NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctaaaattaaaggcacggtcgtgatcgacaaagagcgatgcaaaggatgcaatctc tgcgtggtggcttgtcccgtgcaggtgctggcgttggccggcgaggtcaacggcaaaggg tacaactattcgcagatggtccgtcccgacgattgtatcggatgtgcgagttgtgcgatc gtatgtcccgacagctgtatcgccgtgtaccgtcagaaattcgaggagtag

DBGET integrated database retrieval system