Alistipes ihumii: NQ491_02290 Help Entry NQ491_02290       CDS       T08511                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism aiu  Alistipes ihumii Pathway aiu00020   Citrate cycle (TCA cycle) aiu01100   Metabolic pathways aiu01110   Biosynthesis of secondary metabolites aiu01120   Microbial metabolism in diverse environments aiu01200   Carbon metabolism aiu01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:aiu00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     NQ491_02290 Enzymes [BR:aiu01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      NQ491_02290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_7 Fer4_2 Fer4_9 Fer4_4 Fer4_16 Fer4_17 Fer4_3 Fer4_15 Fer4_13 Fer4_8 Fer4_22 Motif Other DBs NCBI-ProteinID:  UWN57627 LinkDB All DBs Position complement(558630..558863) Genome browser AA seq 77 aa AA seqDB search MAKIKGTVVVDAERCKGCELCVVACPMKVLALSGEVNGKGYRFSRMVSPEACTGCASCAS VCPDSCITVYRQKFTEP NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcaaagattaaggggacggtcgtagtcgacgccgaacgctgcaagggatgcgagctg tgcgtggtcgcttgtccgatgaaggttctcgcgttgagcggcgaggtcaacggcaagggt tatcgtttctcgcggatggtttcgcccgaggcttgtacgggttgcgcttcttgcgcgagc gtttgtcccgatagttgcattacggtgtacaggcagaagtttacggagccctga

DBGET integrated database retrieval system