Amycolatopsis japonica: AJAP_32125 Help Entry AJAP_32125        CDS       T03225                                  Name (GenBank) Hypothetical protein   KO K05375   MbtH protein Organism aja  Amycolatopsis japonica Pathway aja00261   Monobactam biosynthesis aja01100   Metabolic pathways aja01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aja00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AJAP_32125  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:aja01008]     AJAP_32125 Polyketide biosynthesis proteins [BR:aja01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AJAP_32125 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIG79239 UniProt:  A0A075V406 LinkDB All DBs Position complement(6850158..6850367) Genome browser AA seq 69 aa AA seqDB search MSNPFDNEDGSFFVLVNDEGQHSLWPTFAEVPAGWTRVHGEAPRQECLAYVEEHWTDLRP KSLIAEVNG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcaatccctttgacaacgaagacggttcctttttcgtgctggtgaacgacgagggc cagcactccctctggccgacgttcgccgaggttcccgcgggctggacccgcgtccacggc gaggccccgcgccaggaatgcctcgcctacgtcgaggagcactggacggacctgcggccg aagagcctgatcgccgaagtcaacggctga

DBGET integrated database retrieval system