Acinonyx jubatus (cheetah): 106976013 Help Entry 106976013         CDS       T04657                                  Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism aju  Acinonyx jubatus (cheetah) Pathway aju01523   Antifolate resistance aju04010   MAPK signaling pathway aju04060   Cytokine-cytokine receptor interaction aju04064   NF-kappa B signaling pathway aju04217   Necroptosis aju04380   Osteoclast differentiation aju04620   Toll-like receptor signaling pathway aju04621   NOD-like receptor signaling pathway aju04623   Cytosolic DNA-sensing pathway aju04625   C-type lectin receptor signaling pathway aju04640   Hematopoietic cell lineage aju04657   IL-17 signaling pathway aju04659   Th17 cell differentiation aju04668   TNF signaling pathway aju04750   Inflammatory mediator regulation of TRP channels aju04932   Non-alcoholic fatty liver disease aju04933   AGE-RAGE signaling pathway in diabetic complications aju04936   Alcoholic liver disease aju04940   Type I diabetes mellitus aju05010   Alzheimer disease aju05020   Prion disease aju05022   Pathways of neurodegeneration - multiple diseases aju05132   Salmonella infection aju05133   Pertussis aju05134   Legionellosis aju05135   Yersinia infection aju05140   Leishmaniasis aju05142   Chagas disease aju05143   African trypanosomiasis aju05144   Malaria aju05146   Amoebiasis aju05152   Tuberculosis aju05162   Measles aju05163   Human cytomegalovirus infection aju05164   Influenza A aju05168   Herpes simplex virus 1 infection aju05171   Coronavirus disease - COVID-19 aju05321   Inflammatory bowel disease aju05323   Rheumatoid arthritis aju05332   Graft-versus-host disease aju05417   Lipid and atherosclerosis aju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106976013    04064 NF-kappa B signaling pathway     106976013    04668 TNF signaling pathway     106976013   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     106976013  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     106976013  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     106976013    04620 Toll-like receptor signaling pathway     106976013    04621 NOD-like receptor signaling pathway     106976013    04623 Cytosolic DNA-sensing pathway     106976013    04625 C-type lectin receptor signaling pathway     106976013    04659 Th17 cell differentiation     106976013    04657 IL-17 signaling pathway     106976013   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     106976013   09158 Development and regeneration    04380 Osteoclast differentiation     106976013  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     106976013    05164 Influenza A     106976013    05162 Measles     106976013    05168 Herpes simplex virus 1 infection     106976013    05163 Human cytomegalovirus infection     106976013   09171 Infectious disease: bacterial    05132 Salmonella infection     106976013    05135 Yersinia infection     106976013    05133 Pertussis     106976013    05134 Legionellosis     106976013    05152 Tuberculosis     106976013   09174 Infectious disease: parasitic    05146 Amoebiasis     106976013    05144 Malaria     106976013    05140 Leishmaniasis     106976013    05142 Chagas disease     106976013    05143 African trypanosomiasis     106976013   09163 Immune disease    05323 Rheumatoid arthritis     106976013    05321 Inflammatory bowel disease     106976013    05332 Graft-versus-host disease     106976013   09164 Neurodegenerative disease    05010 Alzheimer disease     106976013    05020 Prion disease     106976013    05022 Pathways of neurodegeneration - multiple diseases     106976013   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     106976013    05418 Fluid shear stress and atherosclerosis     106976013   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     106976013    04936 Alcoholic liver disease     106976013    04932 Non-alcoholic fatty liver disease     106976013    04933 AGE-RAGE signaling pathway in diabetic complications     106976013   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     106976013  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aju04052]     106976013    00536 Glycosaminoglycan binding proteins [BR:aju00536]     106976013 Cytokines and neuropeptides [BR:aju04052]  Cytokines   Interleukins    106976013 Glycosaminoglycan binding proteins [BR:aju00536]  Heparan sulfate / Heparin   Cytokines    106976013 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  106976013 NCBI-ProteinID:  XP_014928878 UniProt:  A0A6I9ZV73 LinkDB All DBs Position A3:100565153..100571981 Genome browser AA seq 269 aa AA seqDB search MAMAAVPELTSEMMAYYSDENDLFFEADGPEKMKGCLQNLSHSFLGDEGIQLQISHQPDN KSLRHAVSVIVAMEKLKKISFPCSQPLQDEDLKSLFCCIFEEEPIICDTWDDSFVCDAAI QSQDYTFRDISQKSLVLSGSYELRALHLNGQNMNQQVVFRMSFVHGEENSKKIPVVLCIK KNNLYLSCVMKDGKPTLQLEMLDPKVYPKKKMEKRFVFNKTEIKGNVEFESSQFPNWYIS TSQAEEMPVFLGNTKGGQDITDFIMESAS NT seq 810 nt NT seq  +upstreamnt  +downstreamnt atggccatggcagcagtacctgaactcaccagtgaaatgatggcttactacagtgatgag aatgacctgttctttgaggctgatggccccgaaaagatgaagggctgcctccaaaacctg agccacagttttctgggagatgagggcatccagttgcaaatctcccaccagcccgacaac aagagtcttaggcatgccgtgtcggtcattgtggctatggagaaactgaagaagatatct tttccctgctcacaacccctccaggatgaggacctgaagagcctcttttgctgcatcttt gaagaagaacccatcatctgtgacacgtgggatgacagttttgtgtgtgatgcggccata cagtcacaggactacacgttccgagacataagccaaaagagcctggtgctgtctggctca tacgagcttcgggctctccacctcaatggacagaatatgaaccaacaagtggtgttccgc atgagctttgtacatggggaggaaaacagtaagaagataccagtggtgttgtgcatcaag aaaaataatctgtacctgtcctgtgtgatgaaagacgggaaacccaccctacagctggag atgttagaccccaaagtttacccaaagaagaagatggaaaagcgatttgtcttcaacaag acagaaatcaagggcaatgtggaatttgagtcttcccagttccccaactggtacatcagc acctctcaagcagaagaaatgcctgtcttcctaggaaataccaaaggtggtcaggatata actgacttcatcatggaaagtgcttcctaa

DBGET integrated database retrieval system