Aulosira laxa: NIES50_68460 Help Entry NIES50_68460      CDS       T09879                                  Name (GenBank) putative MbtH-like protein   KO K05375   MbtH protein Organism alax  Aulosira laxa Pathway alax00261   Monobactam biosynthesis alax01100   Metabolic pathways alax01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:alax00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NIES50_68460  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:alax01008]     NIES50_68460 Polyketide biosynthesis proteins [BR:alax01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NIES50_68460 BRITE hierarchy Motif Pfam:  MbtH LPD24 Motif Other DBs NCBI-ProteinID:  BAZ78213 LinkDB All DBs Position plasmid1:complement(259217..259438) Genome browser AA seq 73 aa AA seqDB search MANNEQNDETIYLVVVNHEEQYSIWPQWKQELPLGWKAVGKEGNKTECLAYIEEVWTDMR PLSLRQAMQESSK NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggctaacaacgaacaaaacgacgaaactatatatcttgtagttgtcaatcatgaagaa caatattcaatttggccgcaatggaaacaagaattaccattaggatggaaagcagtaggc aaagaaggtaataaaaccgaatgtttagcctatatcgaagaagtctggactgatatgcgt cctttaagcctccgccaagcaatgcaagaatcatcaaagtaa

DBGET integrated database retrieval system