Alteromonas sp. Mac1: AV939_03785 Help Entry AV939_03785       CDS       T05687                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ale  Alteromonas sp. Mac1 Pathway ale00790   Folate biosynthesis ale01100   Metabolic pathways ale01240   Biosynthesis of cofactors Module ale_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ale00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     AV939_03785 Enzymes [BR:ale01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      AV939_03785  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      AV939_03785  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      AV939_03785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AMJ85780 LinkDB All DBs Position 903907..904260 Genome browser AA seq 117 aa AA seqDB search MGKIYITGLAVDTLIGVYDWERERLTTLLLDVELDADLDAAMQSDNVDDTINYADVADCI TEVGKNSRFMLLEAFGGAVMKQVLATFPAHAIRLKIVKPNILPNAQTVAVAMYQDKS NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgggaaaaatatatataacagggctagctgtcgataccctcatcggtgtgtacgattgg gaacgggagcgtttaaccacgttgttgctcgatgttgaactcgacgctgacctagatgct gcaatgcagtcggataatgttgatgacaccattaactatgccgacgtggctgattgcatt actgaggttggaaaaaacagtcgctttatgctgctagaggcatttggtggcgctgtaatg aagcaagtacttgccacctttccggcccatgctattcgcttgaaaattgtgaagccgaat attcttcctaatgcacaaacggtggcagtggctatgtatcaggataagtcctag

DBGET integrated database retrieval system