Alloactinosynnema sp. L-07: CRK56683 Help Entry CRK56683          CDS       T04489                                  Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism alo  Alloactinosynnema sp. L-07 Pathway alo00261   Monobactam biosynthesis alo01100   Metabolic pathways alo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:alo00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CRK56683  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:alo01008]     CRK56683 Polyketide biosynthesis proteins [BR:alo01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CRK56683 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CRK56683 UniProt:  A0A0H5CHE3 LinkDB All DBs Position I:1698844..1699068 Genome browser AA seq 74 aa AA seqDB search MSGNPFDDENSEFLVLVNEENQHSLWPTFAEVPAGWTSVFGAASRASCVEFIERSWTDMR PTSLVVAMRADGRA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgtccggcaatcccttcgacgacgagaacagtgagttcctcgtcctggtcaacgaagag aaccagcactcgctgtggccgaccttcgccgaggtgcccgcggggtggacctcggtcttc ggggccgcgtcacgtgcgtcgtgcgtcgagttcatcgagcgttcgtggacggacatgcgg ccgacgagcctggtcgtggcgatgcgcgccgacgggcgggcgtga

DBGET integrated database retrieval system