Alloactinosynnema sp. L-07: CRK62216 Help Entry CRK62216          CDS       T04489                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism alo  Alloactinosynnema sp. L-07 Pathway alo00261   Monobactam biosynthesis alo01100   Metabolic pathways alo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:alo00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CRK62216  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:alo01008]     CRK62216 Polyketide biosynthesis proteins [BR:alo01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CRK62216 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CRK62216 UniProt:  A0A0H5CVP9 LinkDB All DBs Position I:complement(7369087..7369269) Genome browser AA seq 60 aa AA seqDB search MIYKVVVNDEEQYSIWPADKENAMGWRDEGTSGTKEECLAHIQEVWTDMRPRSLRERMDS NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgatctacaaggtcgtcgtcaacgacgaggagcagtactcgatctggcccgcggacaag gagaacgccatgggctggcgcgacgagggcaccagcggcaccaaggaggagtgtctggcc cacatccaggaggtgtggaccgacatgcgcccgcgcagcctgcgcgaacgcatggattcc tag

DBGET integrated database retrieval system