Alteromonas mediterranea DE1: amad1_21578 Help Entry amad1_21578       CDS       T02340                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism amaa  Alteromonas mediterranea DE1 Pathway amaa00261   Monobactam biosynthesis amaa01100   Metabolic pathways amaa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amaa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     amad1_21578  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amaa01008]     amad1_21578 Polyketide biosynthesis proteins [BR:amaa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     amad1_21578 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFV87749 LinkDB All DBs Position pAMDE1:complement(178393..178632) Genome browser AA seq 79 aa AA seqDB search MNSELKQSAFLVVVNDEGQYSIWPEAKEIPLGWKSEGTQGSEQQCLAHIDKAWTDMRPHS LKEGWDKQHASRSCAEFQR NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaattctgagctaaaacagtcagccttcttagttgttgttaacgacgaaggacaatac tcgatatggcccgaagcaaaagaaattccgctggggtggaagtccgaaggtacgcaaggc agtgaacaacaatgccttgcacatatcgacaaggcttggactgatatgcgacctcacagc ctcaaagaaggctgggacaaacagcatgcgtcgcgctcctgcgctgagtttcaaagatga

DBGET integrated database retrieval system