Alteromonas mediterranea U7: I876_01380 Help Entry I876_01380        CDS       T02721                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism amae  Alteromonas mediterranea U7 Pathway amae00261   Monobactam biosynthesis amae01100   Metabolic pathways amae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amae00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     I876_01380  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amae01008]     I876_01380 Polyketide biosynthesis proteins [BR:amae01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     I876_01380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGP88169 LinkDB All DBs Position complement(323644..323883) Genome browser AA seq 79 aa AA seqDB search MNSELKQSAFLVVVNDEGQYSIWPEAKEIPLGWKSEGTQGSEQQCLAHIDKAWTDMRPHS LKEGWDKQHASRSCAEFQR NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaattctgagctaaaacagtcagccttcttagttgttgttaacgacgaaggacaatac tcgatatggcccgaagcaaaagaaattccgctggggtggaagtccgaaggtacgcaaggc agtgaacaacaatgccttgcacatatcgacaaggcttggactgatatgcgacctcacagc ctcaaagaaggctgggacaaacagcatgcgtcgcgctcctgcgctgagtttcaaagatga

DBGET integrated database retrieval system