Aquitalea magnusonii: DLM_1060 Help Entry DLM_1060          CDS       T05698                                  Name (GenBank) acyl-CoA hydrolase   KO K10806   acyl-CoA thioesterase YciA [EC:3.1.2.-] Organism amah  Aquitalea magnusonii Pathway amah01040   Biosynthesis of unsaturated fatty acids Brite KEGG Orthology (KO) [BR:amah00001]  09100 Metabolism   09103 Lipid metabolism    01040 Biosynthesis of unsaturated fatty acids     DLM_1060  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:amah01004]     DLM_1060 Lipid biosynthesis proteins [BR:amah01004]  Fatty acid synthase   Component type    DLM_1060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  4HBT MaoC_dehydratas 4HBT_2 Motif Other DBs NCBI-ProteinID:  BBF84700 UniProt:  A0A3G9G9U7 LinkDB All DBs Position 1101349..1101636 Genome browser AA seq 95 aa AA seqDB search MGQIDMAGSLDAERLARGPVATVAVNAFQFTHPILLGDVVNLYVERLRVGQKSVTLKISV EAERLDGELVFVTEVIATFVAIDMDGRSRNLAEVV NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggggcagatcgatatggcgggtagccttgatgctgaaaggttggcgcgcggccctgtg gctacggttgcggtgaatgcctttcagttcacccatcccatcctgctgggcgatgtggtc aatctgtatgtggaaagactgcgcgtgggacaaaagtcggtgaccttgaagatttcggtc gaggcggaaaggctggatggtgagctggtatttgtcaccgaggtgatcgctacttttgta gcgatcgatatggatgggagatctcgtaatttggctgaagttgtttga

DBGET integrated database retrieval system