Alteromonas mediterranea UM7: I635_21584 Help Entry I635_21584        CDS       T02724                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism amai  Alteromonas mediterranea UM7 Pathway amai00261   Monobactam biosynthesis amai01100   Metabolic pathways amai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amai00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     I635_21584  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amai01008]     I635_21584 Polyketide biosynthesis proteins [BR:amai01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     I635_21584 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGP99771 UniProt:  S5C8K6 LinkDB All DBs Position unnamed:complement(178393..178632) Genome browser AA seq 79 aa AA seqDB search MNSELKQSAFLVVVNDEGQYSIWPEAKEIPLGWKSEGTQGSEQQCLAHIDKAWTDMRPHS LKEGWDKQHASRSCAEFQR NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaattctgagctaaaacagtcagccttcttagttgttgttaacgacgaaggacaatac tcgatatggcccgaagcaaaagaaattccgctggggtggaagtccgaaggtacgcaaggc agtgaacaacaatgccttgcacatatcgacaaggcttggactgatatgcgacctcacagc ctcaaagaaggctgggacaaacagcatgcgtcgcgctcctgcgctgagtttcaaagatga

DBGET integrated database retrieval system