Alteromonas mediterranea U4: I607_20292 Help Entry I607_20292        CDS       T02720                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism amal  Alteromonas mediterranea U4 Pathway amal00261   Monobactam biosynthesis amal01100   Metabolic pathways amal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amal00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     I607_20292  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amal01008]     I607_20292 Polyketide biosynthesis proteins [BR:amal01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     I607_20292 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGP87789 LinkDB All DBs Position unnamed:complement(178393..178632) Genome browser AA seq 79 aa AA seqDB search MNSELKQSAFLVVVNDEGQYSIWPEAKEIPLGWKSEGTQGSEQQCLAHIDKAWTDMRPHS LKEGWDKQHASRSCAEFQR NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaattctgagctaaaacagtcagccttcttagttgttgttaacgacgaaggacaatac tcgatatggcccgaagcaaaagaaattccgctggggtggaagtccgaaggtacgcaaggc agtgaacaacaatgccttgcacatatcgacaaggcttggactgatatgcgacctcacagc ctcaaagaaggctgggacaaacagcatgcgtcgcgctcctgcgctgagtttcaaagatga

DBGET integrated database retrieval system