Alteromonas mediterranea U8: I634_01480 Help Entry I634_01480        CDS       T02722                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism amao  Alteromonas mediterranea U8 Pathway amao00261   Monobactam biosynthesis amao01100   Metabolic pathways amao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amao00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     I634_01480  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amao01008]     I634_01480 Polyketide biosynthesis proteins [BR:amao01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     I634_01480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGP92046 LinkDB All DBs Position complement(339012..339251) Genome browser AA seq 79 aa AA seqDB search MNSELKQSAFLVVVNDEGQYSIWPEAKEIPLGWKSEGTQGSEQQCLAHIDKAWTDMRPHS LKEGWDKQHASRSCAEFQR NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaattctgagctaaaacagtcagccttcttagttgttgttaacgacgaaggacaatac tcgatatggcccgaagcaaaagaaattccgctggggtggaagtccgaaggtacgcaaggc agtgaacaacaatgccttgcacatatcgacaaggcttggactgatatgcgacctcacagc ctcaaagaaggctgggacaaacagcatgcgtcgcgctcctgcgctgagtttcaaagatga

DBGET integrated database retrieval system