Actinomadura madurae: LUW76_44535 Help Entry LUW76_44535       CDS       T08933                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism amaz  Actinomadura madurae Pathway amaz00261   Monobactam biosynthesis amaz01100   Metabolic pathways amaz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amaz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LUW76_44535  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amaz01008]     LUW76_44535 Polyketide biosynthesis proteins [BR:amaz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LUW76_44535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  URN01857 LinkDB All DBs Position 9340073..9340261 Genome browser AA seq 62 aa AA seqDB search MYLVLVNDENQHSLWPVFIDVPDGWKTVFGEAGRQECLDYIEKSWTDMRPKSLIEAMEKM EK NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgtacctggttctcgtcaacgacgagaaccagcactcgctgtggccggtattcatcgac gtgccggacggctggaaaacggtgttcggggaggccggccggcaggaatgcctcgactac atagagaagtcctggacggacatgcggcccaagagcctgatcgaggccatggagaagatg gagaagtag

DBGET integrated database retrieval system