Amycolatopsis mediterranei U32: AMED_4768 Help Entry AMED_4768         CDS       T01269                                  Symbol mbtH Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism amd  Amycolatopsis mediterranei U32 Pathway amd00261   Monobactam biosynthesis amd01100   Metabolic pathways amd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AMED_4768 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amd01008]     AMED_4768 (mbtH) Polyketide biosynthesis proteins [BR:amd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AMED_4768 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADJ46534 UniProt:  A0A0H3DAG3 LinkDB All DBs Position complement(5257654..5257881) Genome browser AA seq 75 aa AA seqDB search MSENEAGTDRYVVVVNDEEQYSIWPEGKDVPAGWRTDGAAGSKEDCLRHVEEVWIDMRPL SLRRKMADRQATANG NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtcggagaacgaggccgggacggaccgctacgtggtggtcgtcaacgacgaggagcag tactcgatctggccggagggcaaggacgtgcccgcgggctggcgcaccgacggcgccgcc gggtccaaagaggactgcctgcggcacgtcgaggaggtctggatcgacatgcgccccctc agtctccgccggaagatggccgaccggcaagccacggccaacggctga

DBGET integrated database retrieval system