Astyanax mexicanus (Mexican tetra): 103030846 Help Entry 103030846         CDS       T05042                                  Name (RefSeq) ferritin heavy chain-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex00860   Porphyrin metabolism amex04216   Ferroptosis amex04217   Necroptosis Brite KEGG Orthology (KO) [BR:amex00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     103030846  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     103030846    04217 Necroptosis     103030846  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:amex04147]     103030846 Enzymes [BR:amex01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      103030846 Exosome [BR:amex04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103030846   Exosomal proteins of bladder cancer cells    103030846 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Motif Other DBs NCBI-GeneID:  103030846 NCBI-ProteinID:  XP_022535769 Ensembl:  ENSAMXG00000004881 LinkDB All DBs Position 3:complement(8873882..8877125) Genome browser AA seq 115 aa AA seqDB search MQSVVKHNLHSESEGAINKLINIKLTASYTYLSLGMYFDRDDVALPNFSKYFLERSVKER EHAEHLLGYQNMRGGRVLLQTIAVSVGPGLKSFLLCRIFCFVFIMLPAQCFSLLQ NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgcagtctgtagttaaacacaacctccattcagagagtgagggagccattaataagctc atcaacatcaagctcacagcgtcctacacctacttgtctttgggcatgtattttgaccga gacgatgtggctctgcccaacttctccaaatattttctggagcgctctgtgaaggagagg gagcatgctgagcatttgctggggtatcaaaacatgagaggtggaagagttcttcttcag actattgcggtgagtgtgggtcccggtttaaagtcttttcttctgtgcaggatcttctgc tttgtctttattatgttgccagcccagtgtttctcattgctccagtaa

DBGET integrated database retrieval system