Alteromonas mediterranea 615: I633_03540 Help Entry I633_03540        CDS       T02719                                  Name (GenBank) dihydroneopterin aldolase FolB   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism amh  Alteromonas mediterranea 615 Pathway amh00790   Folate biosynthesis amh01100   Metabolic pathways amh01240   Biosynthesis of cofactors Module amh_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:amh00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     I633_03540 Enzymes [BR:amh01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      I633_03540  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      I633_03540  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      I633_03540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AGP76992 UniProt:  S5A9H5 LinkDB All DBs Position 701272..701625 Genome browser AA seq 117 aa AA seqDB search MGKIYITGLEVDTLIGVYDWERVRTTQLLLDVTLDVDLCAAMQSDDVADTVDYAKVAECI VDVGKQSTFELLEAFGSKVMDAVCEHFAVSAITLKIVKPNILPNAKTVAVEMSKERV NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgggtaaaatttatataacagggcttgaagtcgacaccctgattggtgtttatgattgg gagcgagtacgcacaacgcaactgctgcttgatgtaacacttgacgttgacctatgcgcc gcaatgcaaagcgatgacgtagcagataccgtagattacgcgaaagtggcagagtgtatt gtagatgtaggtaaacaaagtacgtttgaactactcgaagcgtttggaagcaaagtgatg gacgccgtatgcgaacactttgcggtatcggccataacgcttaaaatagtaaaaccaaat atccttcctaatgcgaaaaccgtggcagttgaaatgagtaaagagcgcgtttga

DBGET integrated database retrieval system