Aminobacterium sp. MB27-C1: RBH88_07845 Help Entry RBH88_07845       CDS       T09908                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism amiz  Aminobacterium sp. MB27-C1 Pathway amiz00020   Citrate cycle (TCA cycle) amiz01100   Metabolic pathways amiz01110   Biosynthesis of secondary metabolites amiz01120   Microbial metabolism in diverse environments amiz01200   Carbon metabolism amiz01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:amiz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     RBH88_07845 Enzymes [BR:amiz01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      RBH88_07845 BRITE hierarchy Motif Pfam:  Fer4 Fer4_6 Fer4_7 Fer4_2 Fer4_4 Fer4_21 Fer4_10 Fer4_9 Fer4_13 Fer4_22 Fer4_3 Fer4_15 Fer4_16 Fer4_8 Fer4_17 ETF_QO Motif Other DBs NCBI-ProteinID:  WMI70770 LinkDB All DBs Position complement(1615212..1615412) Genome browser AA seq 66 aa AA seqDB search MTIHIDKDLCKGCGLCANACPVNVYEITGETNRKGFAVVTALHAERCVGCKVCEKTCPDL ALFIEV NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgaccatacatattgataaagatttatgtaaaggatgtggactttgtgccaatgcttgt cccgttaacgtttatgaaattacgggagaaacaaatcgtaaaggttttgctgttgtaaca gcccttcatgcagaaaggtgcgtcggatgcaaagtatgcgaaaaaacgtgtcctgattta gctttatttattgaagtatag

DBGET integrated database retrieval system