Amycolatopsis mediterranei S699: AMES_4709 Help Entry AMES_4709         CDS       T02190                                  Symbol mbtH Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism amm  Amycolatopsis mediterranei S699 Pathway amm00261   Monobactam biosynthesis amm01100   Metabolic pathways amm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amm00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AMES_4709 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amm01008]     AMES_4709 (mbtH) Polyketide biosynthesis proteins [BR:amm01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AMES_4709 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFO78245 LinkDB All DBs Position complement(5266876..5267103) Genome browser AA seq 75 aa AA seqDB search MSENEAGTDRYVVVVNDEEQYSIWPEGKDVPAGWRTDGAAGSKEDCLRHVEEVWIDMRPL SLRRKMADRQATANG NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtcggagaacgaggccgggacggaccgctacgtggtggtcgtcaacgacgaggagcag tactcgatctggccggagggcaaggacgtgcccgcgggctggcgcaccgacggcgccgcc gggtccaaagaggactgcctgcggcacgtcgaggaggtctggatcgacatgcgccccctc agtctccgccggaagatggccgaccggcaagccacggccaacggctga

DBGET integrated database retrieval system