Amycolatopsis mediterranei S699: RAM_20570 Help Entry RAM_20570         CDS       T01822                                  Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism amn  Amycolatopsis mediterranei S699 Pathway amn00261   Monobactam biosynthesis amn01100   Metabolic pathways amn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     RAM_20570  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amn01008]     RAM_20570 Polyketide biosynthesis proteins [BR:amn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     RAM_20570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AEK42594 UniProt:  A0A9R0U9A0 LinkDB All DBs Position 4419903..4420106 Genome browser AA seq 67 aa AA seqDB search MTSPFDDENGRFLVLVNAEEERSIWPVFAAVPPGWEVSLGESSRADAVAHVEATWTDLRP KSLRDAG NT seq 204 nt NT seq  +upstreamnt  +downstreamnt gtgacgagtcctttcgacgacgagaacggccggttcctcgtcctggtcaacgccgaggaa gagcgcagcatctggccggtgttcgccgcggtgccgccggggtgggaggtctcgctgggg gagagttcccgtgcggacgcggtcgcccacgtcgaggccacctggacggacctgcgcccg aagagcctgcgggacgccggctga

DBGET integrated database retrieval system