Amycolatopsis mediterranei S699: RAM_24400 Help Entry RAM_24400         CDS       T01822                                  Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism amn  Amycolatopsis mediterranei S699 Pathway amn00261   Monobactam biosynthesis amn01100   Metabolic pathways amn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     RAM_24400  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amn01008]     RAM_24400 Polyketide biosynthesis proteins [BR:amn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     RAM_24400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AEK43360 UniProt:  A0A9R0NZD6 LinkDB All DBs Position complement(5292492..5292695) Genome browser AA seq 67 aa AA seqDB search MFENTGTFQVVVNDEEQYSIWPADRDLPTGWHAEGTTGPQEDCLAHIDAVWTDMRPRSLR ERMAAAH NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgttcgagaacaccggcacgttccaggtcgtcgtcaacgacgaggagcagtactcgatc tggcccgcggaccgcgacctgcccaccggctggcacgcggagggcacgaccgggccgcag gaggactgcctggcccacatcgacgcggtgtggaccgacatgcggccgcgcagcttgcgc gagcgcatggccgcagcgcactga

DBGET integrated database retrieval system