Acetomicrobium mobile: Anamo_0227 Help Entry Anamo_0227        CDS       T02151                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism amo  Acetomicrobium mobile Pathway amo00020   Citrate cycle (TCA cycle) amo01100   Metabolic pathways amo01110   Biosynthesis of secondary metabolites amo01120   Microbial metabolism in diverse environments amo01200   Carbon metabolism amo01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:amo00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Anamo_0227 Enzymes [BR:amo01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Anamo_0227 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_9 Fer4_21 Fer4_2 Fer4_10 Fer4_6 Fer4_8 Fer4_17 Fer4_4 Fer4_15 Fer4_16 Fer4_13 Fer4_3 Fer4_22 ETF_QO Fer4_18 Motif Other DBs NCBI-ProteinID:  AFM20888 UniProt:  I4BUD1 LinkDB All DBs Position 223751..223999 Genome browser AA seq 82 aa AA seqDB search MTLPEGEVEVAEGKAFRIEIRRDRCKACEICVEFCPKNVFEPDELGRPIPKRVDDCIGCG TCELRCPDFAIEIKSKECHDVD NT seq 249 nt NT seq  +upstreamnt  +downstreamnt ttgacgttacctgagggcgaagttgaggtggctgaggggaaggctttccgaatagagata agacgagataggtgcaaagcatgcgaaatatgtgtggaattttgccccaaaaatgtcttt gagccagacgagctgggtcgccctatccccaagagagtggatgattgcatagggtgcggg acttgcgaattacgctgtcctgatttcgccattgaaataaagtcgaaggagtgtcatgac gttgattga

DBGET integrated database retrieval system