Amycolatopsis methanolica: AMETH_0599 Help Entry AMETH_0599        CDS       T03230                                  Name (GenBank) mbtH protein   KO K05375   MbtH protein Organism amq  Amycolatopsis methanolica Pathway amq00261   Monobactam biosynthesis amq01100   Metabolic pathways amq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amq00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AMETH_0599  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amq01008]     AMETH_0599 Polyketide biosynthesis proteins [BR:amq01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AMETH_0599 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIJ20691 UniProt:  A0A076MP37 LinkDB All DBs Position 586663..586869 Genome browser AA seq 68 aa AA seqDB search MTNPFDDDNGRFYALVNDEGQYSLWPTFAEVPAGWRIVFGEDSRQACLDHIEANWTDMRP RSLVESES NT seq 207 nt NT seq  +upstreamnt  +downstreamnt gtgacgaaccccttcgacgacgacaacgggcgcttctacgcgctggtcaacgacgagggc cagtactcgctgtggcccaccttcgcggaggtgcccgcgggctggcggatcgtcttcggg gaggacagccgccaggcgtgcctggaccacatcgaggccaactggaccgacatgcgaccg cgcagcctggtcgagagcgagtcctga

DBGET integrated database retrieval system