Amycolatopsis sp. BJA-103: BKN51_28895 Help Entry BKN51_28895       CDS       T05296                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism amyb  Amycolatopsis sp. BJA-103 Pathway amyb00261   Monobactam biosynthesis amyb01100   Metabolic pathways amyb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amyb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BKN51_28895  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amyb01008]     BKN51_28895 Polyketide biosynthesis proteins [BR:amyb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BKN51_28895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AUI61787 UniProt:  A0A2N8N0W6 LinkDB All DBs Position 6648691..6648909 Genome browser AA seq 72 aa AA seqDB search MANPFEVPDAEYAVLRNQQNQHSLWPADVAVPDGWTVVHGPGPRTECLAYVREHWVDIRP TQVAEFIAAVPR NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggccaacccgttcgaagtaccggacgccgaatacgccgtgctgcgcaaccagcagaac cagcactcgctgtggcccgccgacgtcgccgtaccggatggctggaccgtcgtgcacggg ccagggccccggacggagtgcctggcctatgtgcgcgagcattgggtggatatccgtccg acgcaggtcgccgagttcatcgccgcggtgccccgatga

DBGET integrated database retrieval system