Amycolatopsis sp. AA4: CU254_12970 Help Entry CU254_12970       CDS       T05278                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism amyc  Amycolatopsis sp. AA4 Pathway amyc00261   Monobactam biosynthesis amyc01100   Metabolic pathways amyc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amyc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CU254_12970  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amyc01008]     CU254_12970 Polyketide biosynthesis proteins [BR:amyc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CU254_12970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ATY11277 UniProt:  A0A2K8LS61 LinkDB All DBs Position complement(2748150..2748371) Genome browser AA seq 73 aa AA seqDB search MTNPFDDDNGRFYALVNDEGQFSLWPVFAEVPSGWRVEFGEDSRQACLDYIEANWRDLRP LSLVRAMDGEPGA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt ttgacgaaccccttcgacgacgacaacggccggttctacgccctggtcaacgacgagggc cagttctccctgtggcccgtcttcgccgaggtcccgtcgggctggcgagtcgagttcggc gaggattcgcgccaggcctgcctcgactacatcgaggcgaactggcgcgacctgcgcccg ctcagcctggtccgcgcgatggacggcgagcccggcgcgtga

DBGET integrated database retrieval system