Amycolatopsis sp. AA4: CU254_16025 Help Entry CU254_16025       CDS       T05278                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism amyc  Amycolatopsis sp. AA4 Pathway amyc00261   Monobactam biosynthesis amyc01100   Metabolic pathways amyc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amyc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CU254_16025  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amyc01008]     CU254_16025 Polyketide biosynthesis proteins [BR:amyc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CU254_16025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF4456 Motif Other DBs NCBI-ProteinID:  ATY11804 UniProt:  A0A2K8LTQ9 LinkDB All DBs Position 3403666..3403863 Genome browser AA seq 65 aa AA seqDB search MDDGVVFQVLVNDEEQYSLWPGDKEVPAGWRPEGMRGSREECMSHVDQVWTDMRPRSLRE RMAAE NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atggatgacggggttgtgtttcaggttttggtcaatgacgaggagcagtattcgttgtgg cctggggacaaggaggttccggctgggtggcggccggaggggatgcgggggagccgggag gagtgcatgagtcacgtggatcaggtgtggactgatatgcggcctcgtagtttgcgggag aggatggcggcggaatag

DBGET integrated database retrieval system