Amycolatopsis sp. AA4: CU254_20490 Help Entry CU254_20490       CDS       T05278                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism amyc  Amycolatopsis sp. AA4 Pathway amyc00261   Monobactam biosynthesis amyc01100   Metabolic pathways amyc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amyc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CU254_20490  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amyc01008]     CU254_20490 Polyketide biosynthesis proteins [BR:amyc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CU254_20490 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ATY12571 UniProt:  A0A2K8LW13 LinkDB All DBs Position complement(4390610..4390789) Genome browser AA seq 59 aa AA seqDB search MYRVLVNEEGQHNLWPDFLAVPEGWRTTFGPDARHACLDYLEQAWADLRPLSLQARDES NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atctaccgggtcctcgtgaacgaggagggccagcacaacctgtggccggatttcctagca gtgccggagggctggcgaaccactttcggtccggacgcgcggcacgcctgcctggactac ctcgagcaggcctgggccgacctgcgcccgctctcgcttcaggcgcgagacgagtcctaa

DBGET integrated database retrieval system