Amycolatopsis sp. YIM 10: YIM_17240 Help Entry YIM_17240         CDS       T06270                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism amyy  Amycolatopsis sp. YIM 10 Pathway amyy00261   Monobactam biosynthesis amyy01100   Metabolic pathways amyy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amyy00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     YIM_17240  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amyy01008]     YIM_17240 Polyketide biosynthesis proteins [BR:amyy01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     YIM_17240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QFU88628 UniProt:  A0A5P9PJZ5 LinkDB All DBs Position 3518704..3518904 Genome browser AA seq 66 aa AA seqDB search MSEEDTTYTVVLNEEEQYSIWPAGRDLPAGWRTDGTRGTKAECLAHIGEVWTDMRPRSVR EQLESR NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgagcgaggaggacaccacctacaccgtggtgctgaacgaggaggagcagtactcgatc tggccggcgggccgggacctcccggcgggctggcgcaccgacggcacccggggcacgaag gccgagtgcctcgcccacatcggtgaggtgtggacggacatgcggccgcggagcgtgcgg gagcagctggaaagccggtga

DBGET integrated database retrieval system