Amycolatopsis sp. YIM 10: YIM_40210 Help Entry YIM_40210         CDS       T06270                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism amyy  Amycolatopsis sp. YIM 10 Pathway amyy00261   Monobactam biosynthesis amyy01100   Metabolic pathways amyy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amyy00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     YIM_40210  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amyy01008]     YIM_40210 Polyketide biosynthesis proteins [BR:amyy01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     YIM_40210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QFU93181 UniProt:  A0A5P9PY39 LinkDB All DBs Position complement(8609760..8609954) Genome browser AA seq 64 aa AA seqDB search MSNPFDNPDGTFSVLVNEEQQHSLWPEFAEVPAGWTVAFGPAPRQECLDYVETNWTDLRP ASLR NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccccttcgacaaccccgacggcacgttctccgtgctggtcaacgaggagcag cagcacagcctgtggccggagttcgccgaggtgccggccggctggacggtcgccttcgga cctgccccgcgccaggagtgcctggactacgtcgagaccaactggaccgacctgcgccca gcttccctgcgctga

DBGET integrated database retrieval system