Amycolatopsis mediterranei RB: B737_3070 Help Entry B737_3070         CDS       T02804                                  Symbol mbtH Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism amz  Amycolatopsis mediterranei RB Pathway amz00261   Monobactam biosynthesis amz01100   Metabolic pathways amz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     B737_3070 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amz01008]     B737_3070 (mbtH) Polyketide biosynthesis proteins [BR:amz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     B737_3070 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGT83734 LinkDB All DBs Position 3338449..3338649 Genome browser AA seq 66 aa AA seqDB search MQDDAEFQVLVNDEGQYSLWPVANEVPAGWRADGFRGGRQECMDHVDEVWTDMRPLSLQR QMAADG NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgcaggacgacgccgaattccaggtgctggtgaacgacgagggccagtactcgctgtgg ccggtggccaacgaggtacccgcggggtggcgcgccgacggcttccgcggcggccgccag gagtgcatggaccacgtcgacgaggtgtggaccgacatgcggccgctgagcctgcagcgg cagatggccgccgacggctga

DBGET integrated database retrieval system