Amycolatopsis mediterranei RB: B737_4734 Help Entry B737_4734         CDS       T02804                                  Symbol mbtH Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism amz  Amycolatopsis mediterranei RB Pathway amz00261   Monobactam biosynthesis amz01100   Metabolic pathways amz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     B737_4734 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amz01008]     B737_4734 (mbtH) Polyketide biosynthesis proteins [BR:amz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     B737_4734 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGT85398 LinkDB All DBs Position complement(5301615..5301818) Genome browser AA seq 67 aa AA seqDB search MFENTGTFQVVVNDEEQYSIWPADRDLPTGWHAEGTTGPQEDCLAHIDAVWTDMRPRSLR ERMAAAH NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgttcgagaacaccggcacgttccaggtcgtcgtcaacgacgaggagcagtactcgatc tggcccgcggaccgcgacctgcccaccggctggcacgcggagggcacgaccgggccgcag gaggactgcctggcccacatcgacgcggtgtggaccgacatgcggccgcgcagcttgcgc gagcgcatggccgcagcgcactga

DBGET integrated database retrieval system