Aspergillus niger (black aspergilli): An01g07250 Help Entry An01g07250        CDS       T01030                                  Name (RefSeq) uncharacterized protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism ang  Aspergillus niger (black aspergilli) Pathway ang03020   RNA polymerase ang03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ang00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     An01g07250   09124 Replication and repair    03420 Nucleotide excision repair     An01g07250  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ang03021]     An01g07250    03400 DNA repair and recombination proteins [BR:ang03400]     An01g07250 Transcription machinery [BR:ang03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      An01g07250   RNA polymerase III system    RNA polymerase III      An01g07250   RNA polymerase I system    RNA polymerase I      An01g07250 DNA repair and recombination proteins [BR:ang03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       An01g07250 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_RNApol_7kD DUF2197 zinc-ribbon_6 DUF5816 YjdM_Zn_Ribbon DZR FtrD-like DZR_2 zinc-ribbons_6 HypA Zn-ribbon_8 Motif Other DBs NCBI-GeneID:  4977472 NCBI-ProteinID:  XP_001389149 UniProt:  A2Q9B0 LinkDB All DBs Position II AA seq 74 aa AA seqDB search MSREQYQVPNLGGGAQNAFGDAGGPMDGPVVAYLCGECNSRVSLKRGDQIRCKECGHRVL YKERTKRMVQFEAR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgtcccgcgaacaataccaagtccccaacctgggcggcggcgcccagaacgccttcggt gatgccggtggtcccatggacggccctgtcgtcgcgtacctgtgcggcgagtgcaactct cgtgtttctctgaagaggggagatcagattcgctgcaaggagtgcggtcatcgcgttttg tataaggagcggacgaagagaatggttcagttcgaggctcggtga

DBGET integrated database retrieval system