Aspergillus niger (black aspergilli): An12g03900 Help Entry An12g03900        CDS       T01030                                  Name (RefSeq) uncharacterized protein   KO K03017   DNA-directed RNA polymerase II subunit RPB9 Organism ang  Aspergillus niger (black aspergilli) Pathway ang03020   RNA polymerase ang03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ang00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     An12g03900   09124 Replication and repair    03420 Nucleotide excision repair     An12g03900  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ang03021]     An12g03900    03400 DNA repair and recombination proteins [BR:ang03400]     An12g03900 Transcription machinery [BR:ang03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol II specific subunits      An12g03900 DNA repair and recombination proteins [BR:ang03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       An12g03900 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TFIIS_C RNA_POL_M_15KD Lar_restr_allev Motif Other DBs NCBI-GeneID:  4985738 NCBI-ProteinID:  XP_059604427 LinkDB All DBs Position III AA seq 119 aa AA seqDB search MVSFDLYTLVGPSANVYSSNLLYPKEDRINNRLMFTCRTCHVGEPATSYCVYQNKLNTQV GDTAGVTQDVGSDPTLPRSNKLCPSCGEAEAVFFQSQQRSAETGMKLYYVCCACGNVFV NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggtaagttttgatctctacactttggtcggaccttctgctaacgtctacagttccaac ttgctctacccgaaggaagaccgcatcaacaaccggttgatgttcacctgccgaacctgc catgtcggcgagcccgccacctcctactgcgtctatcaaaacaaactcaacactcaagtc ggagataccgccggtgtgacccaggatgtgggatctgatcctacgcttcctcgttccaac aagctctgcccgagctgcggcgaagccgaagcagtcttcttccagtcgcaacagcgttcc gctgaaacgggaatgaaactttactacgtctgttgcgcgtgcggcaatgttttcgtctaa

DBGET integrated database retrieval system