Anoxybacillus sp. B7M1: GFC29_2993 Help Entry GFC29_2993        CDS       T04426                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism anl  Anoxybacillus sp. B7M1 Pathway anl00261   Monobactam biosynthesis anl01100   Metabolic pathways anl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:anl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     GFC29_2993  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:anl01008]     GFC29_2993 Polyketide biosynthesis proteins [BR:anl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     GFC29_2993 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANB63657 UniProt:  A0A160FA08 LinkDB All DBs Position 3018253..3018459 Genome browser AA seq 68 aa AA seqDB search MTNPFENQDGTYVVLINEEGQYSLWPSSIAVPSGWKIVFSENTRAACHDYIHTHWTDMRP NSLREIKK NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaccaacccttttgaaaatcaagatgggacctatgttgtcttaatcaatgaggaaggc cagtactcgctctggccgtcctccattgcggttccttccggttggaaaattgtgttttca gaaaatacacgtgccgcttgccacgattatattcatacacactggacggacatgaggcct aacagtttgcgagaaatcaaaaaataa

DBGET integrated database retrieval system