Anoxybacillus sp. B2M1: GFC28_2442 Help Entry GFC28_2442        CDS       T04370                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism anm  Anoxybacillus sp. B2M1 Pathway anm00261   Monobactam biosynthesis anm01100   Metabolic pathways anm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:anm00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     GFC28_2442  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:anm01008]     GFC28_2442 Polyketide biosynthesis proteins [BR:anm01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     GFC28_2442 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANB57732 LinkDB All DBs Position complement(2441377..2441583) Genome browser AA seq 68 aa AA seqDB search MTNPFENQDGTYVVLINEEGQYSLWPSSIAVPSGWKIVFSENTRAACHDYIHTHWTDMRP NSLREIKK NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaccaacccttttgaaaatcaagatgggacctatgttgtcttaatcaatgaggaaggc cagtactcgctctggccgtcctccattgcggttccttccggttggaaaattgtgttttca gaaaatacacgtgccgcttgccacgattatattcatacacactggacggacatgaggcct aacagtttgcgagaaatcaaaaaataa

DBGET integrated database retrieval system