Azoarcus olearius DQS4: dqs_3359 Help Entry dqs_3359          CDS       T04423                                  Name (GenBank) FolB protein   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism aoa  Azoarcus olearius DQS4 Pathway aoa00790   Folate biosynthesis aoa01100   Metabolic pathways aoa01240   Biosynthesis of cofactors Module aoa_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:aoa00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     dqs_3359 Enzymes [BR:aoa01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      dqs_3359  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      dqs_3359  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      dqs_3359 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ANQ86380 UniProt:  A1KAI2 LinkDB All DBs Position complement(3629537..3629914) Genome browser AA seq 125 aa AA seqDB search MDFIFIEELRVQAWVGIYAREKAAPQTVELNLTFGVPDAAAEHDDIADTINYAEVIERIR AELAGRHFNLIETLGEFVVALLFDEFGAPWVKIRIAKIGVMKGVRRVGVFIQRGREGVSL PAGPL NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggatttcatcttcatcgaggagttgcgggtgcaggcgtgggtgggaatctacgcccgt gaaaaagctgcgccgcaaaccgtcgaactcaacctcaccttcggtgttcccgacgcggcg gcggagcacgacgacatcgccgacaccatcaactatgccgaagtgatagagcgcatccgt gccgaattggcggggcggcatttcaatttgatcgagacgctgggcgagttcgtcgtggcg ttactgttcgacgaattcggcgcgccctgggtgaaaatacggattgccaaaatcggcgta atgaaaggcgtccgccgcgtgggggtgttcatacagcgcgggcgggagggcgtttcgctt ccggctggtccgctgtga

DBGET integrated database retrieval system