Amycolatopsis keratiniphila: AORI_4539 Help Entry AORI_4539         CDS       T02678                                  Symbol mbtH Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism aoi  Amycolatopsis keratiniphila Pathway aoi00261   Monobactam biosynthesis aoi01100   Metabolic pathways aoi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aoi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AORI_4539 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:aoi01008]     AORI_4539 (mbtH) Polyketide biosynthesis proteins [BR:aoi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AORI_4539 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGM07123 UniProt:  R4T986 LinkDB All DBs Position 4979843..4980046 Genome browser AA seq 67 aa AA seqDB search MSSNPFDDPDGRFLVLVNHEDQRSLWPAFAEVPDGWRVELGETDRRRCLDHIERVWTDLR PRSLADG NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgagcagcaatcccttcgacgaccccgacggccgcttcctggtgctcgtcaaccacgag gaccagcgttccctgtggcccgccttcgccgaggttcccgacggctggcgggtggaactg ggcgaaacggaccggcggcgatgtctggaccacatcgagcgggtctggaccgatctgcgt ccgcgcagcctggccgacggctga

DBGET integrated database retrieval system