Alistipes onderdonkii subsp. vulgaris: A3BBH6_16400 Help Entry A3BBH6_16400      CDS       T06406                                  Symbol folA Name (GenBank) 7,8-dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism aok  Alistipes onderdonkii subsp. vulgaris Pathway aok00790   Folate biosynthesis aok01100   Metabolic pathways aok01240   Biosynthesis of cofactors Module aok_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:aok00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     A3BBH6_16400 (folA) Enzymes [BR:aok01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      A3BBH6_16400 (folA)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      A3BBH6_16400 (folA)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      A3BBH6_16400 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF257 Motif Other DBs NCBI-ProteinID:  BBL01404 UniProt:  A0A4Y1X8U7 LinkDB All DBs Position complement(1957653..1958006) Genome browser AA seq 117 aa AA seqDB search MEYRIVLTRMEFHALHGCYELERKVGNRFTVDLELTAELGHAATDDDVRKTVNYLTAYEV VEMQMRITQHTIERVATNIIEAVYATFPQVRHVKCTVSKLAPPLGGKLEKVSVVLEK NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggaataccgcatcgtcctgacgcgcatggaattccacgcgctgcacggctgctacgag ctggaacgcaaggtaggcaaccgcttcacggtcgacctggaactgacggccgaactgggc catgcggccacggacgacgacgtgcgcaagacggtcaactacctgacggcctacgaagtc gtcgagatgcagatgcgaatcacgcagcacaccatcgagcgggtggcgacgaacatcatc gaggcggtttacgccaccttcccgcaggtgcggcacgtaaaatgcaccgtatcgaaactg gcgccgccgctgggcggaaagctcgagaaggtgagcgtcgtgctggagaaatag

DBGET integrated database retrieval system