Alistipes onderdonkii subsp. vulgaris: A3BBH6_28920 Help Entry A3BBH6_28920      CDS       T06406                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism aok  Alistipes onderdonkii subsp. vulgaris Pathway aok00020   Citrate cycle (TCA cycle) aok01100   Metabolic pathways aok01110   Biosynthesis of secondary metabolites aok01120   Microbial metabolism in diverse environments aok01200   Carbon metabolism aok01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:aok00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     A3BBH6_28920 Enzymes [BR:aok01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      A3BBH6_28920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_2 Fer4_7 Fer4_10 Fer4_21 Fer4_4 Fer4_15 Fer4_9 Fer4_16 Fer4_22 Fer4_13 Fer4_8 Fer4_3 Motif Other DBs NCBI-ProteinID:  BBL02656 UniProt:  A0A4Y1WR81 LinkDB All DBs Position complement(3471617..3471844) Genome browser AA seq 75 aa AA seqDB search MAKIKGTIVVDKERCKGCGVCVASCPCDVLELSAEVNSKGYPISRMVNPDACTGCASCAV ICPDSVITVYRQKFE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggctaaaataaaaggaacaatcgttgtcgacaaggaacggtgcaaagggtgcggggtc tgtgtggcttcgtgtccgtgcgacgtgctggaattgtcggcagaggtgaacagcaagggc tatcccatatcccggatggtgaatcccgatgcctgcacggggtgtgcttcgtgcgcggtg atttgccccgatagcgtcatcacggtttatcgtcaaaaattcgagtag

DBGET integrated database retrieval system